PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.1285s0100.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 349aa    MW: 38702 Da    PI: 9.1987
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.1285s0100.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.87.2e-56271541128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             lppGfrFhPtdeel+++yL++k+++ ++++ ++i +vd++k+ePwdLp k+k +ekewyfFs rd+ky+tg r+nrat++gyWk+tg
  SapurV1A.1285s0100.4.p  27 LPPGFRFHPTDEELITHYLQNKISDADFSC-RAIGDVDLNKCEPWDLPGKAKMGEKEWYFFSLRDRKYPTGVRTNRATNTGYWKTTG 112
                             79****************************.89***************99999********************************** PP

                     NAM  88 kdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                             kdke++++ + +l+g+kktLvfy+grap+gekt+Wvmheyr+
  SapurV1A.1285s0100.4.p 113 KDKEIFNSvTLQLIGMKKTLVFYRGRAPRGEKTNWVMHEYRV 154
                             ******9878889***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.89E-6424175IPR003441NAC domain
PROSITE profilePS5100560.19727175IPR003441NAC domain
PfamPF023653.1E-2928154IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MKPTGDKGKK QVEKEKEMEG DAKEETLPPG FRFHPTDEEL ITHYLQNKIS DADFSCRAIG  60
DVDLNKCEPW DLPGKAKMGE KEWYFFSLRD RKYPTGVRTN RATNTGYWKT TGKDKEIFNS  120
VTLQLIGMKK TLVFYRGRAP RGEKTNWVMH EYRVHAKAAF RASKDEWVVC RIFQKSAGPK  180
KYPPNQSRTG NPFYNLEIGP SVMPPQMMQA AADNFQLPIG RNYMMSNAEL QAELTRVFRA  240
GGSAGINLPM QSPLNNSYSV GGGAGGGCFT VSGLNLNLGG ATSQPVMRPM PPPAMNQQDA  300
TPSMMASAGS FAVEQAGYGA EMNGANGHSN RFMGMQQCMD LENYWPPY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-562618116171NO APICAL MERISTEM PROTEIN
1ut4_B2e-562618116171NO APICAL MERISTEM PROTEIN
1ut7_A2e-562618116171NO APICAL MERISTEM PROTEIN
1ut7_B2e-562618116171NO APICAL MERISTEM PROTEIN
4dul_A2e-562618116171NAC domain-containing protein 19
4dul_B2e-562618116171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00277DAPTransfer from AT2G24430Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011045043.10.0PREDICTED: NAC domain-containing protein 100-like isoform X3
TrEMBLU5FFA70.0U5FFA7_POPTR; Uncharacterized protein
STRINGPOPTR_0018s03910.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.21e-115NAC domain containing protein 38